PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678370972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 334aa    MW: 36171.6 Da    PI: 9.1296
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678370972genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822216.37.4e-67261571133
     DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                g+++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc eAGwvve+DGttyrkg++p   +e++g+sa+++p+ss + s+ s
  678370972  26 GSARRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCLEAGWVVEPDGTTYRKGCRPS-PMEIGGTSANITPSSSRNPSPPS 124
                6899***********************************************************************9.*********************** PP

     DUF822 101 salaspvesysaspksssfpspssldsislasa 133
                s++asp++sy++sp+sss+psps+ d +++ s+
  678370972 125 SYFASPIPSYQPSPSSSSYPSPSRHDAANSLSH 157
                **************************9877644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.0E-6128152IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MIWEGSTASS AEGGAGPPSG AAPAPGSARR KPSWRERENN RRRERRRRAI AAKIYAGLRA  60
QGNYNLPKHC DNNEVLKALC LEAGWVVEPD GTTYRKGCRP SPMEIGGTSA NITPSSSRNP  120
SPPSSYFASP IPSYQPSPSS SSYPSPSRHD AANSLSHPFA FLLNSLPSAL PPLRISSSAP  180
VTPPLSSPRK LPKQTINLEL EALAKESISS FNSPFFAVSA PTSPIRVQRF TPITIPECDE  240
SDTSSTMDSG HWMNFQAYAN APTAIPTSPM FNLMKKPIPQ SVPSRETSMV DTEKGKSKEF  300
DFENMAVKPW EGEKIHDVGM DDLELTLGSG NSRV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12847RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016463430.11e-144PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-113BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLQ94ET31e-133Q94ET3_SOLLC; Mature anther-specific protein LAT61
STRINGSolyc04g079980.2.11e-132(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-93BES1 family protein